PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 717aa    MW: 79561.2 Da    PI: 6.7526
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29170genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.44.3e-25194248156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               kpr+ Wt  LH++F+ea++q+ G ++A+Pk++lelm+v+ L++e+++SHLQkYRl+
  EMT29170 194 KPRMTWTIALHNKFLEAINQI-GLDRAVPKKVLELMNVDYLSRENIASHLQKYRLH 248
               79*******************.********************************97 PP

2Response_reg74.34.7e-25231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+++ +++l+ +l+  +y + +++ dg+ al++l   ++++Dl+++D++mp+mdG++ll+ i  e  +lp+i+++   +++ + + ++ Ga+
      EMT29170  23 VLVVDDDRVCLMVLEALLRCCKY-QPTTVMDGKTALRMLmaGKQQFDLVITDVRMPDMDGFKLLELICLEM-DLPVIMLSVDCDKKVVMKGIDHGAS 117
                   89*****************9999.8899**********9555555**********************8865.9************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   df +Kp+   el +
      EMT29170 118 DFMVKPVRTHELKN 131
                   *******9999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.42E-3319141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.5E-3720157No hitNo description
SMARTSM004488.0E-2821133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.2822137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2223131IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.41E-2524136No hitNo description
SuperFamilySSF466896.81E-18192251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-26193252IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23194248IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MGGDRRQMME DAAEDKFPEG LRVLVVDDDR VCLMVLEALL RCCKYQPTTV MDGKTALRML  60
MAGKQQFDLV ITDVRMPDMD GFKLLELICL EMDLPVIMLS VDCDKKVVMK GIDHGASDFM  120
VKPVRTHELK NIWQHVQRWR NPKAISHIND HDNDVQRVQP ATTDKSKYSG NKRNDGDDSS  180
ENNEGTHISA IHRKPRMTWT IALHNKFLEA INQIGLDRAV PKKVLELMNV DYLSRENIAS  240
HLQKYRLHLK RVKSNPSGDA YERWTSSYNM NNKGNFMHNH EHGRWSVSCG DTASWITNKY  300
GSTGHLAPPV NIQSNFYMGS YLHDGRMPKY VGKLPSDARR FTGFVDPPVS LYDNIPNEIM  360
SDEFPSFNHS NSCADIMRGK IMEISKGKTP SNLQSSFANT TVGGGRSLVA SQVNFPHSNQ  420
LESFAMSSGR LPLQNEKAPF ISNTTSVGGY IEQMAPFNMA SNISSVGTML NGSSALDASR  480
TSTNDTHLVN GERTTSMLHN LQTDDFVSLT QLHDGGDGAS IVPMQEGTLN QQPLNDHLNE  540
INAFSMDDIL SNMHMEGLPH LPILSLGSSI DERGNVFRLS PKKPRIVPKG GPHTVTNGDG  600
GGSIENVEVL LIAWVSYSHP HLGGNLPFIS WPSQPESPRK LVFVLKWLAN ILPIDLAFVP  660
RCLVRTGPKE SSIELVDIVK DGWSDDQRGG GVDHLGCDHG LDKSRTSNGG DVLAIIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-22192252363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8BVY00.0M8BVY0_AEGTA; Two-component response regulator ARR12
STRINGMLOC_10418.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15285415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.19e-65response regulator 12